SCOP 1.75: Domain d1ls5b_: 1ls5 B:

Lineage for d1ls5b_ (1ls5 B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (3 families)

5. Family b.50.1.2: Pepsin-like [50646] (10 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)

7. Species Plasmodium falciparum, plasmepsin IV [TaxId:5833] [74986] (1 PDB entry)

8. Domain d1ls5b_: 1ls5 B: [74241]
   complexed with ihn

Details for d1ls5b_

PDB Entry: 1ls5, 2.8 Å

PDB Description: Crystal structure of plasmepsin IV from P. falciparum in complex with pepstatin A

PDB Compounds: (B:) plasmepsin IV

SCOP Domain Sequences for d1ls5b_:

Sequence; same for both SEQRES and ATOM records:

>d1ls5b_ b.50.1.2 (B:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin IV [TaxId: 5833]}
sendsielddvanlmfygegqigtnkqpfmfifdtgsanlwvpsvncdsigcstkhlyda
sasksyekdgtkveisygsgtvrgyfskdvislgdlslpykfievtdaddlepiysgsef
dgilglgwkdlsigsidpvvvelkkqnkidnalftfylpvhdkhvgyltiggiesdfyeg
pltyeklnhdlywqidldihfgkyvmqkanavvdsgtstitaptsflnkffrdmnvikvp
flplyvttcdnddlptlefhsrnnkytlepefymdplsdidpalcmlyilpvdiddntfi
lgdpfmrkyftvfdyekesvgfavaknl

Timeline for d1ls5b_:

• d1ls5b_ first appeared in SCOP 1.61
  
• d1ls5b_ appears in SCOP 1.73
  
• d1ls5b_ appears in SCOPe 2.01
  
• d1ls5b_ appears in the current release, SCOPe 2.08