Lineage for d1ls5a_ (1ls5 A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 168884Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 168885Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 169255Family b.50.1.2: Pepsin-like [50646] (9 proteins)
  6. 169402Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)
  7. 169412Species Plasmodium falciparum, plasmepsin IV [TaxId:5833] [74986] (1 PDB entry)
  8. 169413Domain d1ls5a_: 1ls5 A: [74240]

Details for d1ls5a_

PDB Entry: 1ls5 (more details), 2.8 Å

PDB Description: Crystal structure of plasmepsin IV from P. falciparum in complex with pepstatin A

SCOP Domain Sequences for d1ls5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ls5a_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin IV}
sendsielddvanlmfygegqigtnkqpfmfifdtgsanlwvpsvncdsigcstkhlyda
sasksyekdgtkveisygsgtvrgyfskdvislgdlslpykfievtdaddlepiysgsef
dgilglgwkdlsigsidpvvvelkkqnkidnalftfylpvhdkhvgyltiggiesdfyeg
pltyeklnhdlywqidldihfgkyvmqkanavvdsgtstitaptsflnkffrdmnvikvp
flplyvttcdnddlptlefhsrnnkytlepefymdplsdidpalcmlyilpvdiddntfi
lgdpfmrkyftvfdyekesvgfavaknl

SCOP Domain Coordinates for d1ls5a_:

Click to download the PDB-style file with coordinates for d1ls5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ls5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ls5b_