Lineage for d1lrma_ (1lrm A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337435Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. 337436Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 337437Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (3 proteins)
  6. 337438Protein Phenylalanine hydroxylase, PAH [56538] (3 species)
  7. 337443Species Human (Homo sapiens) [TaxId:9606] [56539] (11 PDB entries)
  8. 337452Domain d1lrma_: 1lrm A: [74227]
    complexed with fe, hbi

Details for d1lrma_

PDB Entry: 1lrm (more details), 2.1 Å

PDB Description: Crystal structure of binary complex of the catalytic domain of human phenylalanine hydroxylase with dihydrobiopterin (BH2)

SCOP Domain Sequences for d1lrma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lrma_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens)}
vpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpiprv
eymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqtc
tgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsdr
sfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqyc
lsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydpy
tqrievl

SCOP Domain Coordinates for d1lrma_:

Click to download the PDB-style file with coordinates for d1lrma_.
(The format of our PDB-style files is described here.)

Timeline for d1lrma_: