Lineage for d1lrhd_ (1lrh D:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies) 
Superfamily b.82.1: RmlC-like cupins [51182] (5 families) 
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins) 
Protein Auxin binding protein [75030] (1 species) Species Maize (Zea mays) [TaxId:4577] [75031] (2 PDB entries) 
Domain d1lrhd_: 1lrh D: [74222]
Details for d1lrhd_
PDB Entry: 1lrh (more details), 1.9 Å
PDB Description: crystal structure of auxin-binding protein 1 in complex with 1- naphthalene acetic acid
SCOP Domain Sequences for d1lrhd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lrhd_ b.82.1.2 (D:) Auxin binding protein {Maize (Zea mays)}
scvrdnslvrdisqmpqssygieglshitvagalnhgmkevevwlqtispgqrtpihrhs
ceevftvlkgkgtllmgssslkypgqpqeipffqnttfsipvndphqvwnsdehedlqvl
viisrppakiflyddwsmphtaavlkfpfvwdedcfeaak
SCOP Domain Coordinates for d1lrhd_:
Click to download the PDB-style file with coordinates for d1lrhd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lrhd_:
- d1lrhd_ is new in SCOP 1.61
- d1lrhd_ appears in SCOP 1.63
- d1lrhd_ appears in the current release, SCOPe 2.08
View in 3D
