Lineage for d1lrhd_ (1lrh D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814551Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2814552Protein Auxin binding protein [75030] (1 species)
  7. 2814553Species Maize (Zea mays) [TaxId:4577] [75031] (2 PDB entries)
  8. 2814557Domain d1lrhd_: 1lrh D: [74222]
    complexed with nla, zn

Details for d1lrhd_

PDB Entry: 1lrh (more details), 1.9 Å

PDB Description: crystal structure of auxin-binding protein 1 in complex with 1- naphthalene acetic acid
PDB Compounds: (D:) auxin-binding protein 1

SCOPe Domain Sequences for d1lrhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lrhd_ b.82.1.2 (D:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]}
scvrdnslvrdisqmpqssygieglshitvagalnhgmkevevwlqtispgqrtpihrhs
ceevftvlkgkgtllmgssslkypgqpqeipffqnttfsipvndphqvwnsdehedlqvl
viisrppakiflyddwsmphtaavlkfpfvwdedcfeaak

SCOPe Domain Coordinates for d1lrhd_:

Click to download the PDB-style file with coordinates for d1lrhd_.
(The format of our PDB-style files is described here.)

Timeline for d1lrhd_: