Lineage for d1lr5a_ (1lr5 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 809735Superfamily b.82.1: RmlC-like cupins [51182] (24 families) (S)
  5. 809794Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
  6. 809795Protein Auxin binding protein [75030] (1 species)
  7. 809796Species Maize (Zea mays) [TaxId:4577] [75031] (2 PDB entries)
  8. 809797Domain d1lr5a_: 1lr5 A: [74215]

Details for d1lr5a_

PDB Entry: 1lr5 (more details), 1.9 Å

PDB Description: crystal structure of auxin binding protein
PDB Compounds: (A:) Auxin binding protein 1

SCOP Domain Sequences for d1lr5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]}
scvrdnslvrdisqmpqssygieglshitvagalnhgmkevevwlqtispgqrtpihrhs
ceevftvlkgkgtllmgssslkypgqpqeipffqnttfsipvndphqvwnsdehedlqvl
viisrppakiflyddwsmphtaavlkfpfvwdedcfeaak

SCOP Domain Coordinates for d1lr5a_:

Click to download the PDB-style file with coordinates for d1lr5a_.
(The format of our PDB-style files is described here.)

Timeline for d1lr5a_: