Lineage for d1lqya_ (1lqy A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2606868Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 2606869Protein Peptide deformylase [56422] (11 species)
  7. 2606870Species Bacillus stearothermophilus [TaxId:1422] [75580] (1 PDB entry)
  8. 2606871Domain d1lqya_: 1lqy A: [74212]
    complexed with antibiotic actinonin
    complexed with bb2, ni

Details for d1lqya_

PDB Entry: 1lqy (more details), 1.9 Å

PDB Description: Crystal Structure of Bacillus stearothermophilus Peptide Deformylase Complexed with Antibiotic Actinonin
PDB Compounds: (A:) PEPTIDE deformylase 2

SCOPe Domain Sequences for d1lqya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqya_ d.167.1.1 (A:) Peptide deformylase {Bacillus stearothermophilus [TaxId: 1422]}
mitmkdiikeghptlrkvaepvplppseedkrilqslldyvkmsqdpelaakyglrpgig
laapqinvskrmiavhvtdengtlysyalfnpkivshsvqqcylttgegclsvdrdvpgy
vlryaritvtgttldgeevtlrlkglpaivfqheidhlngimfydrinpadpfqvpdgai
pigr

SCOPe Domain Coordinates for d1lqya_:

Click to download the PDB-style file with coordinates for d1lqya_.
(The format of our PDB-style files is described here.)

Timeline for d1lqya_: