Lineage for d1lqva_ (1lqv A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856986Protein Endothelial protein C receptor [75381] (1 species)
    phospholipid-binding protein
  7. 856987Species Human (Homo sapiens) [TaxId:9606] [75382] (2 PDB entries)
  8. 856988Domain d1lqva_: 1lqv A: [74206]
    Other proteins in same PDB: d1lqvc_, d1lqvd_
    complexed with a phospholipid molecule and GLA domain of protein C

Details for d1lqva_

PDB Entry: 1lqv (more details), 1.6 Å

PDB Description: crystal structure of the endothelial protein c receptor with phospholipid in the groove in complex with gla domain of protein c.
PDB Compounds: (A:) Endothelial protein C receptor

SCOP Domain Sequences for d1lqva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqva_ d.19.1.1 (A:) Endothelial protein C receptor {Human (Homo sapiens) [TaxId: 9606]}
glqrlhmlqisyfrdpyhvwyqgnaslgghlthvlegpdtnttiiqlqplqepeswartq
sglqsyllqfhglvrlvhqertlafpltircflgcelppegsrahvffevavngssfvsf
rperalwqadtqvtsgvvtftlqqlnaynrtryelrefledtcvqyvqkhis

SCOP Domain Coordinates for d1lqva_:

Click to download the PDB-style file with coordinates for d1lqva_.
(The format of our PDB-style files is described here.)

Timeline for d1lqva_: