SCOPe 2.08: Domain d1lqub2: 1lqu B:2-108,B:325-456

Lineage for d1lqub2 (1lqu B:2-108,B:325-456)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)

6. Protein Ferredoxin:NADP reductase FprA [75129] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [75130] (2 PDB entries)

8. Domain d1lqub2: 1lqu B:2-108,B:325-456 [74205]
   Other proteins in same PDB: d1lqua1, d1lqub1
   complexed with act, fad, ndp

Details for d1lqub2

PDB Entry: 1lqu, 1.25 Å

PDB Description: Mycobacterium tuberculosis FprA in complex with NADPH

PDB Compounds: (B:) FprA

SCOPe Domain Sequences for d1lqub2:

Sequence, based on SEQRES records:

>d1lqub2 c.4.1.1 (B:2-108,B:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]}
rpyyiaivgsgpsaffaaasllkaadttedldmavdmlemlptpwglvrsgvapdhpkik
siskqfektaedprfrffgnvvvgehvqpgelserydaviyavgaqsXrgvptpglpfdd
qsgtipnvggringspneyvvgwikrgptgvigtnkkdaqdtvdtliknlgnakegaeck
sfpedhadqvadwlaarqpklvtsahwqvidaferaagephgrprvklaslaellriglg

Sequence, based on observed residues (ATOM records):

>d1lqub2 c.4.1.1 (B:2-108,B:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]}
rpyyiaivgsgpsaffaaasllkaadttedldmavdmlemlptpwglvrsgvapdhpkik
siskqfektaedprfrffgnvvvgehvqpgelserydaviyavgaqsXrgvptpglpfdd
qsgtipnvggringspneyvvgwikrgptgvigtnkkdaqdtvdtliknlgnakegaeck
sfpdhadqvadwlaarqpklvtsahwqvidaferaagephgrprvklaslaellriglg

Timeline for d1lqub2:

• d1lqub2 first appeared in SCOP 1.61
  
• d1lqub2 appears in SCOPe 2.07