SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1lqua2 (1lqu A:2-108,A:325-456)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097360Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2097361Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 2097362Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 protein domains)
  6. 2097397Protein Ferredoxin:NADP reductase FprA [75129] (1 species)
  7. 2097398Species Mycobacterium tuberculosis [TaxId:1773] [75130] (2 PDB entries)
  8. 2097401Domain d1lqua2: 1lqu A:2-108,A:325-456 [74203]
    Other proteins in same PDB: d1lqua1, d1lqub1
    complexed with act, fad, ndp

Details for d1lqua2

PDB Entry: 1lqu (more details), 1.25 Å

PDB Description: Mycobacterium tuberculosis FprA in complex with NADPH
PDB Compounds: (A:) FprA

SCOPe Domain Sequences for d1lqua2:

Sequence, based on SEQRES records: (download)

>d1lqua2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]}
rpyyiaivgsgpsaffaaasllkaadttedldmavdmlemlptpwglvrsgvapdhpkik
siskqfektaedprfrffgnvvvgehvqpgelserydaviyavgaqsXrgvptpglpfdd
qsgtipnvggringspneyvvgwikrgptgvigtnkkdaqdtvdtliknlgnakegaeck
sfpedhadqvadwlaarqpklvtsahwqvidaferaagephgrprvklaslaellriglg

Sequence, based on observed residues (ATOM records): (download)

>d1lqua2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]}
rpyyiaivgsgpsaffaaasllkaadttedldmavdmlemlptpwglvrsgvapdhpkik
siskqfektaedprfrffgnvvvgehvqpgelserydaviyavgaqsXrgvptpglpfdd
qsgtipnvggringspneyvvgwikrgptgvigtnkkdaqdtvdtliknlgnakegaeck
sfpdhadqvadwlaarqpklvtsahwqvidaferaagephgrprvklaslaellriglg

SCOPe Domain Coordinates for d1lqua2:

Click to download the PDB-style file with coordinates for d1lqua2.
(The format of our PDB-style files is described here.)

Timeline for d1lqua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lqua1