Lineage for d1lqua1 (1lqu A:109-324)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849310Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins)
  6. 2849361Protein Ferredoxin:NADP reductase FprA [75124] (1 species)
  7. 2849362Species Mycobacterium tuberculosis [TaxId:1773] [75125] (2 PDB entries)
  8. 2849363Domain d1lqua1: 1lqu A:109-324 [74202]
    Other proteins in same PDB: d1lqua2, d1lqub2
    complexed with act, fad, ndp

Details for d1lqua1

PDB Entry: 1lqu (more details), 1.25 Å

PDB Description: Mycobacterium tuberculosis FprA in complex with NADPH
PDB Compounds: (A:) FprA

SCOPe Domain Sequences for d1lqua1:

Sequence, based on SEQRES records: (download)

>d1lqua1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]}
drmlnipgedlpgsiaavdfvgwynahphfeqvspdlsgaravvigngnvaldvarillt
dpdvlartdiadhaleslrprgiqevvivgrrgplqaafttlelreladldgvdvvidpa
eldgitdedaaavgkvckqnikvlrgyadreprpghrrmvfrfltspieikgkrkveriv
lgrnelvsdgsgrvaakdtgereelpaqlvvrsvgy

Sequence, based on observed residues (ATOM records): (download)

>d1lqua1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]}
drmlnipgedlpgsiaavdfvgwynahphfeqvspdlsgaravvigngnvaldvarillt
dpdvlartdiadhaleslrprgiqevvivgrrgplqaafttlelreladldgvdvvidpa
eldgitdedaaavgkvckqnikvlrgyadrerpghrrmvfrfltspieikgkrkverivl
grnelvsdgsgrvaakdtgereelpaqlvvrsvgy

SCOPe Domain Coordinates for d1lqua1:

Click to download the PDB-style file with coordinates for d1lqua1.
(The format of our PDB-style files is described here.)

Timeline for d1lqua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lqua2