Lineage for d1lqtb2 (1lqt B:2-108,B:325-456)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097360Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2097361Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 2097362Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 protein domains)
  6. 2097397Protein Ferredoxin:NADP reductase FprA [75129] (1 species)
  7. 2097398Species Mycobacterium tuberculosis [TaxId:1773] [75130] (2 PDB entries)
  8. 2097400Domain d1lqtb2: 1lqt B:2-108,B:325-456 [74201]
    Other proteins in same PDB: d1lqta1, d1lqtb1
    complexed with act, fad, odp

Details for d1lqtb2

PDB Entry: 1lqt (more details), 1.05 Å

PDB Description: a covalent modification of nadp+ revealed by the atomic resolution structure of fpra, a mycobacterium tuberculosis oxidoreductase
PDB Compounds: (B:) FprA

SCOPe Domain Sequences for d1lqtb2:

Sequence, based on SEQRES records: (download)

>d1lqtb2 c.4.1.1 (B:2-108,B:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]}
rpyyiaivgsgpsaffaaasllkaadttedldmavdmlemlptpwglvrsgvapdhpkik
siskqfektaedprfrffgnvvvgehvqpgelserydaviyavgaqsXrgvptpglpfdd
qsgtipnvggringspneyvvgwikrgptgvigtnkkdaqdtvdtliknlgnakegaeck
sfpedhadqvadwlaarqpklvtsahwqvidaferaagephgrprvklaslaellriglg

Sequence, based on observed residues (ATOM records): (download)

>d1lqtb2 c.4.1.1 (B:2-108,B:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]}
rpyyiaivgsgpsaffaaasllkaadttedldmavdmlemlptpwglvrsgvapdhpkik
siskqfektaedprfrffgnvvvgehvqpgelserydaviyavgaqsXrgvptpglpfdd
qsgtipnvggringspneyvvgwikrgptgvigtnkkdaqdtvdtliknlgnakegaeck
sfpdhadqvadwlaarqpklvtsahwqvidaferaagephgrprvklaslaellriglg

SCOPe Domain Coordinates for d1lqtb2:

Click to download the PDB-style file with coordinates for d1lqtb2.
(The format of our PDB-style files is described here.)

Timeline for d1lqtb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lqtb1