SCOPe 2.08: Domain d1lqtb2: 1lqt B:2-108,B:325-456

Lineage for d1lqtb2 (1lqt B:2-108,B:325-456)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)

6. Protein Ferredoxin:NADP reductase FprA [75129] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [75130] (2 PDB entries)

8. Domain d1lqtb2: 1lqt B:2-108,B:325-456 [74201]
   Other proteins in same PDB: d1lqta1, d1lqtb1
   complexed with act, fad, odp

Details for d1lqtb2

PDB Entry: 1lqt, 1.05 Å

PDB Description: a covalent modification of nadp+ revealed by the atomic resolution structure of fpra, a mycobacterium tuberculosis oxidoreductase

PDB Compounds: (B:) FprA

SCOPe Domain Sequences for d1lqtb2:

Sequence, based on SEQRES records:

>d1lqtb2 c.4.1.1 (B:2-108,B:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]}
rpyyiaivgsgpsaffaaasllkaadttedldmavdmlemlptpwglvrsgvapdhpkik
siskqfektaedprfrffgnvvvgehvqpgelserydaviyavgaqsXrgvptpglpfdd
qsgtipnvggringspneyvvgwikrgptgvigtnkkdaqdtvdtliknlgnakegaeck
sfpedhadqvadwlaarqpklvtsahwqvidaferaagephgrprvklaslaellriglg

Sequence, based on observed residues (ATOM records):

>d1lqtb2 c.4.1.1 (B:2-108,B:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]}
rpyyiaivgsgpsaffaaasllkaadttedldmavdmlemlptpwglvrsgvapdhpkik
siskqfektaedprfrffgnvvvgehvqpgelserydaviyavgaqsXrgvptpglpfdd
qsgtipnvggringspneyvvgwikrgptgvigtnkkdaqdtvdtliknlgnakegaeck
sfpdhadqvadwlaarqpklvtsahwqvidaferaagephgrprvklaslaellriglg

Timeline for d1lqtb2:

• d1lqtb2 first appeared in SCOP 1.61
  
• d1lqtb2 appears in SCOPe 2.07