Lineage for d1lqtb1 (1lqt B:109-324)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 309374Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 309375Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 309376Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (4 proteins)
  6. 309408Protein Ferredoxin:NADP reductase FprA [75124] (1 species)
  7. 309409Species Mycobacterium tuberculosis [TaxId:1773] [75125] (2 PDB entries)
  8. 309411Domain d1lqtb1: 1lqt B:109-324 [74200]
    Other proteins in same PDB: d1lqta2, d1lqtb2
    complexed with act, fad, odp

Details for d1lqtb1

PDB Entry: 1lqt (more details), 1.05 Å

PDB Description: a covalent modification of nadp+ revealed by the atomic resolution structure of fpra, a mycobacterium tuberculosis oxidoreductase

SCOP Domain Sequences for d1lqtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqtb1 c.3.1.1 (B:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis}
drmlnipgedlpgsiaavdfvgwynahphfeqvspdlsgaravvigngnvaldvarillt
dpdvlartdiadhaleslrprgiqevvivgrrgplqaafttlelreladldgvdvvidpa
eldgitdedaaavgkvckqnikvlrgyadreprpghrrmvfrfltspieikgkrkveriv
lgrnelvsdgsgrvaakdtgereelpaqlvvrsvgy

SCOP Domain Coordinates for d1lqtb1:

Click to download the PDB-style file with coordinates for d1lqtb1.
(The format of our PDB-style files is described here.)

Timeline for d1lqtb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lqtb2