Lineage for d1lqss1 (1lqs S:2-100)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 160936Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 160937Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 161077Protein Interleukin-10 receptor 1, IL-10R1 [63670] (1 species)
  7. 161078Species Human (Homo sapiens) [TaxId:9606] [63671] (2 PDB entries)
  8. 161081Domain d1lqss1: 1lqs S:2-100 [74196]
    Other proteins in same PDB: d1lqsl_, d1lqsm_

Details for d1lqss1

PDB Entry: 1lqs (more details), 2.7 Å

PDB Description: crystal structure of human cytomegalovirus il-10 bound to soluble human il-10r1

SCOP Domain Sequences for d1lqss1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqss1 b.1.2.1 (S:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens)}
gtelpsppsvwfeaeffhhilhwtpipqqsestcyevallrygieswnsisqcsqtlsyd
ltavtldlyhsngyrarvravdgsrhsqwtvtntrfsvd

SCOP Domain Coordinates for d1lqss1:

Click to download the PDB-style file with coordinates for d1lqss1.
(The format of our PDB-style files is described here.)

Timeline for d1lqss1: