SCOP 1.65: Domain d1lqsr1: 1lqs R:2-100

Lineage for d1lqsr1 (1lqs R:2-100)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (20 proteins)

6. Protein Interleukin-10 receptor 1, IL-10R1 [63670] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63671] (2 PDB entries)

8. Domain d1lqsr1: 1lqs R:2-100 [74194]
   Other proteins in same PDB: d1lqsl_, d1lqsm_

Details for d1lqsr1

PDB Entry: 1lqs, 2.7 Å

PDB Description: crystal structure of human cytomegalovirus il-10 bound to soluble human il-10r1

SCOP Domain Sequences for d1lqsr1:

Sequence; same for both SEQRES and ATOM records:

>d1lqsr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens)}
gtelpsppsvwfeaeffhhilhwtpipqqsestcyevallrygieswnsisqcsqtlsyd
ltavtldlyhsngyrarvravdgsrhsqwtvtntrfsvd

Timeline for d1lqsr1:

• d1lqsr1 first appeared in SCOP 1.61
  
• d1lqsr1 appears in SCOP 1.63
  
• d1lqsr1 appears in SCOP 1.67
  
• d1lqsr1 appears in the current release, SCOPe 2.08