Lineage for d1lqsl_ (1lqs L:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280090Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 280091Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglments of the two crossover connections
  5. 280231Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins)
    contains an additional helix in one of the crossover connections
  6. 280278Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species)
    intertwined dimer, similar to interferon-gamma
  7. 280288Species Human herpesvirus 5 [TaxId:10359] [74708] (1 PDB entry)
  8. 280289Domain d1lqsl_: 1lqs L: [74192]
    Other proteins in same PDB: d1lqsr1, d1lqsr2, d1lqss1, d1lqss2

Details for d1lqsl_

PDB Entry: 1lqs (more details), 2.7 Å

PDB Description: crystal structure of human cytomegalovirus il-10 bound to soluble human il-10r1

SCOP Domain Sequences for d1lqsl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqsl_ a.26.1.3 (L:) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human herpesvirus 5}
tkpqcrpedyatrlqdlrvtfhrvkptlqreddysvwldgtvvkgcwgcsvmdwllrryl
eivfpagdhvypglktelhsmrstlesiykdmrqcpllgcgdksvisrlsqeaerksdng
trkglseldtlfsrleeylhsr

SCOP Domain Coordinates for d1lqsl_:

Click to download the PDB-style file with coordinates for d1lqsl_.
(The format of our PDB-style files is described here.)

Timeline for d1lqsl_: