Class a: All alpha proteins [46456] (179 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (3 families) there are two different topoisomers of this fold with different entanglments of the two crossover connections |
Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (8 proteins) contains an additional helix in one of the crossover connections |
Protein Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) [47306] (3 species) intertwined dimer, similar to interferon-gamma |
Species Human herpesvirus 5 [TaxId:10359] [74708] (1 PDB entry) |
Domain d1lqsl_: 1lqs L: [74192] Other proteins in same PDB: d1lqsr1, d1lqsr2, d1lqss1, d1lqss2 |
PDB Entry: 1lqs (more details), 2.7 Å
SCOP Domain Sequences for d1lqsl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lqsl_ a.26.1.3 (L:) Interleukin-10 (cytokine synthesis inhibitory factor, CSIF) {Human herpesvirus 5} tkpqcrpedyatrlqdlrvtfhrvkptlqreddysvwldgtvvkgcwgcsvmdwllrryl eivfpagdhvypglktelhsmrstlesiykdmrqcpllgcgdksvisrlsqeaerksdng trkglseldtlfsrleeylhsr
Timeline for d1lqsl_: