SCOPe 2.04: Domain d1lqbc_: 1lqb C:

Lineage for d1lqbc_ (1lqb C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.3: VHL [49468] (1 family)
   automatically mapped to Pfam PF01847

5. Family b.3.3.1: VHL [49469] (2 proteins)

6. Protein VHL [49470] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49471] (17 PDB entries)

8. Domain d1lqbc_: 1lqb C: [74186]
   Other proteins in same PDB: d1lqba_, d1lqbb_
   complexed with Hif-1alpha oxyproline peptide (chain D)
   complexed with so4

Details for d1lqbc_

PDB Entry: 1lqb, 2 Å

PDB Description: Crystal structure of a hydroxylated HIF-1 alpha peptide bound to the pVHL/elongin-C/elongin-B complex

PDB Compounds: (C:) von hippel-lindau disease tumor supressor

SCOPe Domain Sequences for d1lqbc_:

Sequence; same for both SEQRES and ATOM records:

>d1lqbc_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]}
pvlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfr
dagthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldi
vrslyedledhpnvqkdlerltqeriahqr

Timeline for d1lqbc_:

• d1lqbc_ first appeared in SCOP 1.61
  
• d1lqbc_ appears in SCOPe 2.03
  
• d1lqbc_ appears in SCOPe 2.05
  
• d1lqbc_ appears in the current release, SCOPe 2.08