Lineage for d1lpqa3 (1lpq A:202-430)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 267021Fold e.15: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56740] (1 superfamily)
    2 domains: alpha+beta and all-beta
  4. 267022Superfamily e.15.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56741] (1 family) (S)
  5. 267023Family e.15.1.1: Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56742] (1 protein)
  6. 267024Protein Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment [56743] (2 species)
  7. 267027Species Human (Homo sapiens) [TaxId:9606] [56744] (7 PDB entries)
  8. 267034Domain d1lpqa3: 1lpq A:202-430 [74176]
    Other proteins in same PDB: d1lpqa1, d1lpqa2
    complexed with 8og; mutant

Details for d1lpqa3

PDB Entry: 1lpq (more details), 3.14 Å

PDB Description: human dna topoisomerase i (70 kda) in non-covalent complex with a 22 base pair dna duplex containing an 8-oxog lesion

SCOP Domain Sequences for d1lpqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lpqa3 e.15.1.1 (A:202-430) Eukaryotic DNA topoisomerase I, N-terminal DNA-binding fragment {Human (Homo sapiens)}
kwkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffa
kmldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmsk
eeklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimped
iiincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimln

SCOP Domain Coordinates for d1lpqa3:

Click to download the PDB-style file with coordinates for d1lpqa3.
(The format of our PDB-style files is described here.)

Timeline for d1lpqa3: