SCOP 1.73: Domain d1lpqa2: 1lpq A:431-633,A:713-765

Lineage for d1lpqa2 (1lpq A:431-633,A:713-765)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)

6. Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56363] (15 PDB entries)

8. Domain d1lpqa2: 1lpq A:431-633,A:713-765 [74175]
   Other proteins in same PDB: d1lpqa1, d1lpqa3
   complexed with 8og; mutant

Details for d1lpqa2

PDB Entry: 1lpq, 3.14 Å

PDB Description: human dna topoisomerase i (70 kda) in non-covalent complex with a 22 base pair dna duplex containing an 8-oxog lesion

PDB Compounds: (A:) DNA topoisomerase I

SCOP Domain Sequences for d1lpqa2:

Sequence; same for both SEQRES and ATOM records:

>d1lpqa2 d.163.1.2 (A:431-633,A:713-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens) [TaxId: 9606]}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde
nipakilsynranravailcnhqXqialgtsklnfldpritvawckkwgvpiekiynktq
rekfawaidmadedyef

Timeline for d1lpqa2:

• d1lpqa2 first appeared in SCOP 1.61
  
• d1lpqa2 appears in SCOP 1.71
  
• d1lpqa2 appears in SCOP 1.75
  
• d1lpqa2 appears in the current release, SCOPe 2.08