Lineage for d1lp6b_ (1lp6 B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814383Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 814448Family c.1.2.3: Decarboxylase [51375] (3 proteins)
  6. 814479Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 814480Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (18 PDB entries)
  8. 814506Domain d1lp6b_: 1lp6 B: [74172]
    complexed with c5p

Details for d1lp6b_

PDB Entry: 1lp6 (more details), 1.9 Å

PDB Description: crystal structure of orotidine monophosphate decarboxylase complexed with cmp
PDB Compounds: (B:) orotidine monophosphate decarboxylase

SCOP Domain Sequences for d1lp6b_:

Sequence, based on SEQRES records: (download)

>d1lp6b_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesikdllipe

Sequence, based on observed residues (ATOM records): (download)

>d1lp6b_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispggdpgetlrf
adaiivgrsiyladnpaaaaagiiesikdllipe

SCOP Domain Coordinates for d1lp6b_:

Click to download the PDB-style file with coordinates for d1lp6b_.
(The format of our PDB-style files is described here.)

Timeline for d1lp6b_: