SCOP 1.73: Domain d1lp6b_: 1lp6 B:

Lineage for d1lp6b_ (1lp6 B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families)

5. Family c.1.2.3: Decarboxylase [51375] (3 proteins)

6. Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)

7. Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (18 PDB entries)

8. Domain d1lp6b_: 1lp6 B: [74172]
   complexed with c5p

Details for d1lp6b_

PDB Entry: 1lp6, 1.9 Å

PDB Description: crystal structure of orotidine monophosphate decarboxylase complexed with cmp

PDB Compounds: (B:) orotidine monophosphate decarboxylase

SCOP Domain Sequences for d1lp6b_:

Sequence, based on SEQRES records:

>d1lp6b_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesikdllipe

Sequence, based on observed residues (ATOM records):

>d1lp6b_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispggdpgetlrf
adaiivgrsiyladnpaaaaagiiesikdllipe

Timeline for d1lp6b_:

• d1lp6b_ first appeared in SCOP 1.61
  
• d1lp6b_ appears in SCOP 1.71
  
• d1lp6b_ appears in SCOP 1.75
  
• d1lp6b_ appears in the current release, SCOPe 2.08