![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Protein kinase CK2, alpha subunit [56142] (2 species) CMGC group; CK2 subfamily; serine/threonine kinase |
![]() | Species Maize (Zea mays) [TaxId:4577] [56143] (16 PDB entries) |
![]() | Domain d1lp4a_: 1lp4 A: [74170] complexed with anp, mg |
PDB Entry: 1lp4 (more details), 1.86 Å
SCOP Domain Sequences for d1lp4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lp4a_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]} skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr ydhqerltaleamthpyfqqvraaens
Timeline for d1lp4a_: