Lineage for d1lp3a_ (1lp3 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076263Superfamily b.121.5: ssDNA viruses [88645] (3 families) (S)
  5. 2076282Family b.121.5.2: Parvoviridae-like VP [88646] (3 protein domains)
    automatically mapped to Pfam PF00740
  6. 2076283Protein Dependovirus capsid protein [74887] (1 species)
  7. 2076284Species Adeno-associated virus, aav-2 [TaxId:272636] [74888] (1 PDB entry)
    a vector for human genome therapy
  8. 2076285Domain d1lp3a_: 1lp3 A: [74169]

Details for d1lp3a_

PDB Entry: 1lp3 (more details), 3 Å

PDB Description: The Atomic Structure of Adeno-Associated Virus (AAV-2), a Vector for Human Gene Therapy
PDB Compounds: (A:) AAV-2 capsid protein

SCOPe Domain Sequences for d1lp3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lp3a_ b.121.5.2 (A:) Dependovirus capsid protein {Adeno-associated virus, aav-2 [TaxId: 272636]}
gadgvgnssgnwhcdstwmgdrvittstrtwalptynnhlykqissqsgasndnhyfgys
tpwgyfdfnrfhchfsprdwqrlinnnwgfrpkrlnfklfniqvkevtqndgtttiannl
tstvqvftdseyqlpyvlgsahqgclppfpadvfmvpqygyltlnngsqavgrssfycle
yfpsqmlrtgnnftfsytfedvpfhssyahsqsldrlmnplidqylyylsrtntpsgttt
qsrlqfsqagasdirdqsrnwlpgpcyrqqrvsktsadnnnseyswtgatkyhlngrdsl
vnpgpamashkddeekffpqsgvlifgkqgsektnvdiekvmitdeeeirttnpvateqy
gsvstnlqrgnrqaatadvntqgvlpgmvwqdrdvylqgpiwakiphtdghfhpsplmgg
fglkhpppqilikntpvpanpsttfsaakfasfitqystgqvsveiewelqkenskrwnp
eiqytsnynksvnvdftvdtngvyseprpigtryltrnl

SCOPe Domain Coordinates for d1lp3a_:

Click to download the PDB-style file with coordinates for d1lp3a_.
(The format of our PDB-style files is described here.)

Timeline for d1lp3a_: