SCOPe 2.05: Domain d1lowa_: 1low A:

Lineage for d1lowa_ (1low A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.4: Fungal ribonucleases [81311] (4 proteins)

6. Protein RNase T1 [53939] (2 species)

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [53940] (67 PDB entries)

8. Domain d1lowa_: 1low A: [74167]
   complexed with 3gp, ca; mutant

Details for d1lowa_

PDB Entry: 1low, 1.9 Å

PDB Description: x-ray structure of the h40a mutant of ribonuclease t1 complexed with 3'-guanosine monophosphate

PDB Compounds: (A:) guanyl-specific ribonuclease t1

SCOPe Domain Sequences for d1lowa_:

Sequence; same for both SEQRES and ATOM records:

>d1lowa_ d.1.1.4 (A:) RNase T1 {Fungus (Aspergillus oryzae) [TaxId: 5062]}
acdytcgsncysssdvstaqaagyklhedgetvgsnsypakynnyegfdfsvsspyyewp
ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect

Timeline for d1lowa_:

• d1lowa_ first appeared in SCOP 1.61
  
• d1lowa_ appears in SCOPe 2.04
  
• d1lowa_ appears in SCOPe 2.06
  
• d1lowa_ appears in the current release, SCOPe 2.08