Lineage for d1lota3 (1lot A:387-457)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 777088Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 777089Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 777090Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 777251Protein Vitamin D binding protein [69111] (1 species)
    domain 3 lacks the last subdomain
  7. 777252Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)
  8. 777279Domain d1lota3: 1lot A:387-457 [74163]
    Other proteins in same PDB: d1lotb1, d1lotb2
    complexed with atp, ca, gol, hic

Details for d1lota3

PDB Entry: 1lot (more details), 2.5 Å

PDB Description: crystal structure of the complex of actin with vitamin d-binding protein
PDB Compounds: (A:) Vitamin D-binding protein

SCOP Domain Sequences for d1lota3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lota3 a.126.1.1 (A:387-457) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
gqelcadysentfteykkklaerlkaklpdatptelaklvnkrsdfasnccsinspplyc
dseidaelkni

SCOP Domain Coordinates for d1lota3:

Click to download the PDB-style file with coordinates for d1lota3.
(The format of our PDB-style files is described here.)

Timeline for d1lota3: