SCOPe 2.01: Domain d1lota2: 1lot A:199-386

Lineage for d1lota2 (1lot A:199-386)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (1 family)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Vitamin D binding protein [69111] (1 species)
   domain 3 lacks the last subdomain

7. Species Human (Homo sapiens) [TaxId:9606] [69112] (6 PDB entries)

8. Domain d1lota2: 1lot A:199-386 [74162]
   Other proteins in same PDB: d1lotb1, d1lotb2
   complexed with atp, ca, gol

Details for d1lota2

PDB Entry: 1lot, 2.5 Å

PDB Description: crystal structure of the complex of actin with vitamin d-binding protein

PDB Compounds: (A:) Vitamin D-binding protein

SCOPe Domain Sequences for d1lota2:

Sequence; same for both SEQRES and ATOM records:

>d1lota2 a.126.1.1 (A:199-386) Vitamin D binding protein {Human (Homo sapiens) [TaxId: 9606]}
lsnrvcsqyaaygekksrlsnliklaqkvptadledvlplaeditnilskccesasedcm
akelpehtvklcdnlstknskfedccqektamdvfvctyfmpaaqlpelpdvelptnkdv
cdpgntkvmdkytfelsrrthlpevflskvleptlkslgeccdvedsttcfnakgpllkk
elssfidk

Timeline for d1lota2:

• d1lota2 first appeared in SCOP 1.61
  
• d1lota2 appears in SCOP 1.75
  
• d1lota2 appears in SCOPe 2.02
  
• d1lota2 appears in the current release, SCOPe 2.08