Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (5 families) |
Family c.1.2.3: Decarboxylase [51375] (2 proteins) |
Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species) |
Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries) |
Domain d1losd_: 1los D: [74160] complexed with up6; mutant |
PDB Entry: 1los (more details), 1.9 Å
SCOP Domain Sequences for d1losd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1losd_ c.1.2.3 (D:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum} rrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrf gcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfll temshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvg dpgetlrfadaiivgasiyladnpaaaaagiies
Timeline for d1losd_: