SCOP 1.71: Domain d1losd_: 1los D:

Lineage for d1losd_ (1los D:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (5 families)

5. Family c.1.2.3: Decarboxylase [51375] (2 proteins)

6. Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)

7. Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries)

8. Domain d1losd_: 1los D: [74160]
   complexed with up6; mutant

Details for d1losd_

PDB Entry: 1los, 1.9 Å

PDB Description: crystal structure of orotidine monophosphate decarboxylase mutant deltar203a complexed with 6-azaump

SCOP Domain Sequences for d1losd_:

Sequence; same for both SEQRES and ATOM records:

>d1losd_ c.1.2.3 (D:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum}
rrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrf
gcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfll
temshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvg
dpgetlrfadaiivgasiyladnpaaaaagiies

Timeline for d1losd_:

• d1losd_ first appeared in SCOP 1.61
  
• d1losd_ appears in SCOP 1.69
  
• d1losd_ appears in SCOP 1.73
  
• d1losd_ appears in the current release, SCOPe 2.08