Lineage for d1losd_ (1los D:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 172806Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 172830Family c.1.2.3: Decarboxylase [51375] (2 proteins)
  6. 172837Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)
  7. 172838Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries)
  8. 172866Domain d1losd_: 1los D: [74160]

Details for d1losd_

PDB Entry: 1los (more details), 1.9 Å

PDB Description: crystal structure of orotidine monophosphate decarboxylase mutant deltar203a complexed with 6-azaump

SCOP Domain Sequences for d1losd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1losd_ c.1.2.3 (D:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum}
rrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrf
gcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfll
temshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvg
dpgetlrfadaiivgasiyladnpaaaaagiies

SCOP Domain Coordinates for d1losd_:

Click to download the PDB-style file with coordinates for d1losd_.
(The format of our PDB-style files is described here.)

Timeline for d1losd_: