Lineage for d1losc_ (1los C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 570417Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (5 families) (S)
  5. 570465Family c.1.2.3: Decarboxylase [51375] (2 proteins)
  6. 570488Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)
  7. 570489Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries)
  8. 570516Domain d1losc_: 1los C: [74159]

Details for d1losc_

PDB Entry: 1los (more details), 1.9 Å

PDB Description: crystal structure of orotidine monophosphate decarboxylase mutant deltar203a complexed with 6-azaump

SCOP Domain Sequences for d1losc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1losc_ c.1.2.3 (C:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum}
nrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiadfk
vadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpgae
mfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgdpgetlrfa
daiivgasiyl

SCOP Domain Coordinates for d1losc_:

Click to download the PDB-style file with coordinates for d1losc_.
(The format of our PDB-style files is described here.)

Timeline for d1losc_: