Lineage for d1lora_ (1lor A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 681300Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 681364Family c.1.2.3: Decarboxylase [51375] (3 proteins)
  6. 681395Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 681396Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (18 PDB entries)
  8. 681415Domain d1lora_: 1lor A: [74156]
    complexed with bmp

Details for d1lora_

PDB Entry: 1lor (more details), 1.6 Å

PDB Description: crystal structure of orotidine 5'-monophosphate complexed with bmp
PDB Compounds: (A:) orotidine monophosphate decarboxylase

SCOP Domain Sequences for d1lora_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lora_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
rlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiadfkv
adipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpgaem
fiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpgetl
rfadaiivgrsiyladnpaaaaagiiesi

SCOP Domain Coordinates for d1lora_:

Click to download the PDB-style file with coordinates for d1lora_.
(The format of our PDB-style files is described here.)

Timeline for d1lora_: