Lineage for d1lolb_ (1lol B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473421Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 473466Family c.1.2.3: Decarboxylase [51375] (2 proteins)
  6. 473489Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)
  7. 473490Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries)
  8. 473512Domain d1lolb_: 1lol B: [74151]

Details for d1lolb_

PDB Entry: 1lol (more details), 1.9 Å

PDB Description: Crystal structure of orotidine monophosphate decarboxylase complex with XMP

SCOP Domain Sequences for d1lolb_:

Sequence, based on SEQRES records: (download)

>d1lolb_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesikdllipe

Sequence, based on observed residues (ATOM records): (download)

>d1lolb_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispggdpgetlrf
adaiivgrsiyladnpaaaaagiiesikdllipe

SCOP Domain Coordinates for d1lolb_:

Click to download the PDB-style file with coordinates for d1lolb_.
(The format of our PDB-style files is described here.)

Timeline for d1lolb_: