Lineage for d1lolb_ (1lol B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2826771Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2826811Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (7 species)
  7. 2826848Species Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries)
  8. 2826869Domain d1lolb_: 1lol B: [74151]
    complexed with bu2, xmp

Details for d1lolb_

PDB Entry: 1lol (more details), 1.9 Å

PDB Description: Crystal structure of orotidine monophosphate decarboxylase complex with XMP
PDB Compounds: (B:) orotidine 5'-monophosphate decarboxylase

SCOPe Domain Sequences for d1lolb_:

Sequence, based on SEQRES records: (download)

>d1lolb_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Methanobacterium thermoautotrophicum [TaxId: 145262]}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesikdllipe

Sequence, based on observed residues (ATOM records): (download)

>d1lolb_ c.1.2.3 (B:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Methanobacterium thermoautotrophicum [TaxId: 145262]}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispggdpgetlrf
adaiivgrsiyladnpaaaaagiiesikdllipe

SCOPe Domain Coordinates for d1lolb_:

Click to download the PDB-style file with coordinates for d1lolb_.
(The format of our PDB-style files is described here.)

Timeline for d1lolb_: