Lineage for d1lola_ (1lol A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 235793Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) (S)
  5. 235824Family c.1.2.3: Decarboxylase [51375] (2 proteins)
  6. 235831Protein Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) [51376] (4 species)
  7. 235832Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [51379] (16 PDB entries)
  8. 235853Domain d1lola_: 1lol A: [74150]

Details for d1lola_

PDB Entry: 1lol (more details), 1.9 Å

PDB Description: Crystal structure of orotidine monophosphate decarboxylase complex with XMP

SCOP Domain Sequences for d1lola_:

Sequence, based on SEQRES records: (download)

>d1lola_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdpg
etlrfadaiivgrsiyladnpaaaaagiiesi

Sequence, based on observed residues (ATOM records): (download)

>d1lola_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum}
vmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiad
fkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpg
aemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispggetlrfada
iivgrsiyladnpaaaaagiiesi

SCOP Domain Coordinates for d1lola_:

Click to download the PDB-style file with coordinates for d1lola_.
(The format of our PDB-style files is described here.)

Timeline for d1lola_: