Lineage for d1loha3 (1loh A:541-814)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 372004Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 372072Superfamily b.30.5: Galactose mutarotase-like [74650] (8 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 372200Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
  6. 372218Protein Hyaluronate lyase [50009] (2 species)
  7. 372223Species Streptococcus pneumoniae [TaxId:1313] [50010] (14 PDB entries)
  8. 372236Domain d1loha3: 1loh A:541-814 [74149]
    Other proteins in same PDB: d1loha1, d1loha2
    complexed with gcu, nag; mutant

Details for d1loha3

PDB Entry: 1loh (more details), 2 Å

PDB Description: streptococcus pneumoniae hyaluronate lyase in complex with hexasaccharide hyaluronan substrate

SCOP Domain Sequences for d1loha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1loha3 b.30.5.2 (A:541-814) Hyaluronate lyase {Streptococcus pneumoniae}
tsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwytsdgmfylyngd
lshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtsklddanatatmdftnw
nqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykvyvndkeaslte
qekdypetqsvflessdskknigyfffkkssismskalqkgawkdinegqsdkevenefl
tisqahkqngdsygymlipnvdratfnqmikele

SCOP Domain Coordinates for d1loha3:

Click to download the PDB-style file with coordinates for d1loha3.
(The format of our PDB-style files is described here.)

Timeline for d1loha3: