SCOP 1.63: Domain d1loha3: 1loh A:541-814

Lineage for d1loha3 (1loh A:541-814)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (5 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (2 proteins)

6. Protein Hyaluronate lyase [50009] (2 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [50010] (10 PDB entries)

8. Domain d1loha3: 1loh A:541-814 [74149]
   Other proteins in same PDB: d1loha1, d1loha2
   complexed with gcu, nag; mutant

Details for d1loha3

PDB Entry: 1loh, 2 Å

PDB Description: streptococcus pneumoniae hyaluronate lyase in complex with hexasaccharide hyaluronan substrate

SCOP Domain Sequences for d1loha3:

Sequence; same for both SEQRES and ATOM records:

>d1loha3 b.30.5.2 (A:541-814) Hyaluronate lyase {Streptococcus pneumoniae}
tsylsafnkmdktamynaekgfgfglslfssrtlnyehmnkenkrgwytsdgmfylyngd
lshysdgywptvnpykmpgttetdakradsdtgkvlpsafvgtsklddanatatmdftnw
nqtltahkswfmlkdkiaflgsniqntstdtaattidqrklessnpykvyvndkeaslte
qekdypetqsvflessdskknigyfffkkssismskalqkgawkdinegqsdkevenefl
tisqahkqngdsygymlipnvdratfnqmikele

Timeline for d1loha3:

• d1loha3 first appeared in SCOP 1.61
  
• d1loha3 appears in SCOP 1.65
  
• d1loha3 appears in the current release, SCOPe 2.08