Lineage for d1loha1 (1loh A:170-540)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 155275Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 155358Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
  5. 155364Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (2 proteins)
  6. 155372Protein Hyaluronate lyase [48237] (2 species)
  7. 155376Species Streptococcus pneumoniae [TaxId:1313] [48238] (5 PDB entries)
  8. 155381Domain d1loha1: 1loh A:170-540 [74147]
    Other proteins in same PDB: d1loha2, d1loha3

Details for d1loha1

PDB Entry: 1loh (more details), 2 Å

PDB Description: Streptococcus pneumoniae Hyaluronate Lyase in Complex with Hexasaccharide Hyaluronan Substrate

SCOP Domain Sequences for d1loha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1loha1 a.102.3.2 (A:170-540) Hyaluronate lyase {Streptococcus pneumoniae}
vkdtytdrlddwngiiagnqyydskndqmaklnqelegkvadslssissqadriylwekf
snyktsanltatyrkleemakqvtnpssryyqdetvvrtvrdsmewmhkhvynseksivg
nwwdyeigtprainntlslmkeyfsdeeikkytdviekfvpdpehfrkttdnpfkalggn
lvdmgrvkviagllrkddqeisstirsieqvfklvdqgegfyqdgsyidhtnvaytgafg
nvlidglsqllpviqktknpidkdkmqtmyhwidksfapllvngelmdmsrgrsisrans
eghvaavevlrgihriadmsegetkqrlqslvktivqsdsyydvfknlktykdislmqsl
lsdagvasvpr

SCOP Domain Coordinates for d1loha1:

Click to download the PDB-style file with coordinates for d1loha1.
(The format of our PDB-style files is described here.)

Timeline for d1loha1: