Lineage for d1lo8a_ (1lo8 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2187709Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2187710Protein 4-hydroxybenzoyl-CoA thioesterase [54639] (1 species)
  7. 2187711Species Pseudomonas sp., CBS-3 [TaxId:306] [54640] (4 PDB entries)
  8. 2187713Domain d1lo8a_: 1lo8 A: [74145]
    complexed with 4ca

Details for d1lo8a_

PDB Entry: 1lo8 (more details), 1.8 Å

PDB Description: x-ray crystal structure of 4-hydroxybenzoyl coa thioesterase complexed with 4-hydroxybenzyl coa
PDB Compounds: (A:) 4-hydroxybenzoyl-CoA Thioesterase

SCOPe Domain Sequences for d1lo8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo8a_ d.38.1.1 (A:) 4-hydroxybenzoyl-CoA thioesterase {Pseudomonas sp., CBS-3 [TaxId: 306]}
arsitmqqriefgdcdpagivwypnyhrwldaasrnyfikcglppwrqtvvergivgtpi
vscnasfvctasyddvltietcikewrrksfvqrhsvsrttpggdvqlvmradeirvfam
ndgerlraievpadyielcs

SCOPe Domain Coordinates for d1lo8a_:

Click to download the PDB-style file with coordinates for d1lo8a_.
(The format of our PDB-style files is described here.)

Timeline for d1lo8a_: