Lineage for d1lo6a_ (1lo6 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2065124Protein Kallikrein 6 [74974] (1 species)
  7. 2065125Species Human (Homo sapiens) [TaxId:9606] [74975] (3 PDB entries)
  8. 2065126Domain d1lo6a_: 1lo6 A: [74143]
    complexed with ben, mg

Details for d1lo6a_

PDB Entry: 1lo6 (more details), 1.56 Å

PDB Description: Human Kallikrein 6 (hK6) active form with benzamidine inhibitor at 1.56 A resolution
PDB Compounds: (A:) kallikrein 6

SCOPe Domain Sequences for d1lo6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]}
lvhggpcdktshpyqaalytsghllcggvlihplwvltaahckkpnlqvflgkhnlrqre
ssqeqssvvravihpdydaashdqdimllrlarpaklseliqplplerdcsanttschil
gwgktadgdfpdtiqcayihlvsreecehaypgqitqnmlcagdekygkdscqgdsggpl
vcgdhlrglvswgnipcgskekpgvytnvcrytnwiqktiq

SCOPe Domain Coordinates for d1lo6a_:

Click to download the PDB-style file with coordinates for d1lo6a_.
(The format of our PDB-style files is described here.)

Timeline for d1lo6a_: