Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
Protein Kallikrein 6 [74974] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [74975] (3 PDB entries) |
Domain d1lo6a_: 1lo6 A: [74143] complexed with ben, mg |
PDB Entry: 1lo6 (more details), 1.56 Å
SCOPe Domain Sequences for d1lo6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} lvhggpcdktshpyqaalytsghllcggvlihplwvltaahckkpnlqvflgkhnlrqre ssqeqssvvravihpdydaashdqdimllrlarpaklseliqplplerdcsanttschil gwgktadgdfpdtiqcayihlvsreecehaypgqitqnmlcagdekygkdscqgdsggpl vcgdhlrglvswgnipcgskekpgvytnvcrytnwiqktiq
Timeline for d1lo6a_: