SCOP 1.61: Domain d1lo4l1: 1lo4 L:1-112

Lineage for d1lo4l1 (1lo4 L:1-112)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain [74810] (4 PDB entries)

8. Domain d1lo4l1: 1lo4 L:1-112 [74141]
   Other proteins in same PDB: d1lo4h2, d1lo4l2

Details for d1lo4l1

PDB Entry: 1lo4, 2.4 Å

PDB Description: retro-diels-alderase catalytic antibody 9d9

SCOP Domain Sequences for d1lo4l1:

Sequence; same for both SEQRES and ATOM records:

>d1lo4l1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain}
dvlltqtplslpvslgdqasiscrssqtivhtngntyfewylqkpgqsphlliykvsnrl
sgvpdrfsgsgsgtdftlkisrveaedlglyycfqgshspwtfgggtklelk

Timeline for d1lo4l1:

• d1lo4l1 is new in SCOP 1.61
  
• d1lo4l1 appears in SCOP 1.63
  
• d1lo4l1 appears in the current release, SCOPe 2.08