Lineage for d1lo4h1 (1lo4 H:1-118)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510779Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (14 PDB entries)
    Uniprot P18527 # HV56_MOUSE Ig heavy chain V region 914; 90% sequence identity
  8. 1510797Domain d1lo4h1: 1lo4 H:1-118 [74139]
    Other proteins in same PDB: d1lo4h2, d1lo4l1, d1lo4l2
    part of retro Diels-Alder catalytic Fab 9D9

Details for d1lo4h1

PDB Entry: 1lo4 (more details), 2.4 Å

PDB Description: retro-diels-alderase catalytic antibody 9d9
PDB Compounds: (H:) Ig gamma 2a heavy chain

SCOPe Domain Sequences for d1lo4h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo4h1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]}
elklvetggdlvkpggsltlsceasgftlrtygmswvrqtpqmrlewvasisyggllyfs
dsvkgrftisrdivrniltlqmsrlrsedtaiyycargtsfvryfdvwgagttvtvss

SCOPe Domain Coordinates for d1lo4h1:

Click to download the PDB-style file with coordinates for d1lo4h1.
(The format of our PDB-style files is described here.)

Timeline for d1lo4h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lo4h2