Lineage for d1lo3x1 (1lo3 X:1-112)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158571Species Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain [74810] (4 PDB entries)
  8. 158582Domain d1lo3x1: 1lo3 X:1-112 [74135]
    Other proteins in same PDB: d1lo3h2, d1lo3l2, d1lo3x2, d1lo3y2

Details for d1lo3x1

PDB Entry: 1lo3 (more details), 2.3 Å

PDB Description: Retro-Diels-Alderase Catalytic Antibody: Product Analogue

SCOP Domain Sequences for d1lo3x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo3x1 b.1.1.1 (X:1-112) Immunoglobulin (variable domains of L and H chains) {Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain}
dvlmtqtplslpvslgdqvsifctssqtivhtngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrvetedlgiyycfqgshfplafgagtklelk

SCOP Domain Coordinates for d1lo3x1:

Click to download the PDB-style file with coordinates for d1lo3x1.
(The format of our PDB-style files is described here.)

Timeline for d1lo3x1: