SCOP 1.61: Domain d1lo3l1: 1lo3 L:1-112

Lineage for d1lo3l1 (1lo3 L:1-112)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
Species Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain [74810] (4 PDB entries)
Domain d1lo3l1: 1lo3 L:1-112 [74133]
Other proteins in same PDB: d1lo3h2, d1lo3l2, d1lo3x2, d1lo3y2

Details for d1lo3l1

PDB Entry: 1lo3 (more details), 2.3 Å

PDB Description: Retro-Diels-Alderase Catalytic Antibody: Product Analogue

SCOP Domain Sequences for d1lo3l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo3l1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain}
dvlmtqtplslpvslgdqvsifctssqtivhtngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrvetedlgiyycfqgshfplafgagtklelk

SCOP Domain Coordinates for d1lo3l1:

Click to download the PDB-style file with coordinates for d1lo3l1.
(The format of our PDB-style files is described here.)

Timeline for d1lo3l1: