SCOP 1.63: Domain d1lo3h1: 1lo3 H:1-119

Lineage for d1lo3h1 (1lo3 H:1-119)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain [74810] (4 PDB entries)

8. Domain d1lo3h1: 1lo3 H:1-119 [74131]
   Other proteins in same PDB: d1lo3h2, d1lo3l2, d1lo3x2, d1lo3y2
   complexed with an1

Details for d1lo3h1

PDB Entry: 1lo3, 2.3 Å

PDB Description: Retro-Diels-Alderase Catalytic Antibody: Product Analogue

SCOP Domain Sequences for d1lo3h1:

Sequence; same for both SEQRES and ATOM records:

>d1lo3h1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain}
evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsa

Timeline for d1lo3h1:

• d1lo3h1 first appeared in SCOP 1.61
  
• d1lo3h1 appears in SCOP 1.65
  
• d1lo3h1 appears in the current release, SCOPe 2.08