Lineage for d1lo2l2 (1lo2 L:113-220)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549856Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)
  8. 549940Domain d1lo2l2: 1lo2 L:113-220 [74126]
    Other proteins in same PDB: d1lo2h1, d1lo2h2, d1lo2l1, d1lo2x1, d1lo2y1, d1lo2y2
    part of retro Diels-Alder catalytic Fab 9D9
    complexed with ox1

Details for d1lo2l2

PDB Entry: 1lo2 (more details), 2 Å

PDB Description: retro-diels-alderase catalytic antibody

SCOP Domain Sequences for d1lo2l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo2l2 b.1.1.2 (L:113-220) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1lo2l2:

Click to download the PDB-style file with coordinates for d1lo2l2.
(The format of our PDB-style files is described here.)

Timeline for d1lo2l2: