Lineage for d1lo2l1 (1lo2 L:1-112)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 547289Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547441Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)
  8. 547488Domain d1lo2l1: 1lo2 L:1-112 [74125]
    Other proteins in same PDB: d1lo2h1, d1lo2h2, d1lo2l2, d1lo2x2, d1lo2y1, d1lo2y2
    part of retro Diels-Alder catalytic Fab 9D9
    complexed with ox1

Details for d1lo2l1

PDB Entry: 1lo2 (more details), 2 Å

PDB Description: Retro-Diels-Alderase Catalytic Antibody

SCOP Domain Sequences for d1lo2l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo2l1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvlmtqtplslpvslgdqvsifctssqtivhtngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrvetedlgiyycfqgshfplafgagtklelk

SCOP Domain Coordinates for d1lo2l1:

Click to download the PDB-style file with coordinates for d1lo2l1.
(The format of our PDB-style files is described here.)

Timeline for d1lo2l1: