SCOP 1.65: Domain d1lo2l1: 1lo2 L:1-112

Lineage for d1lo2l1 (1lo2 L:1-112)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (98 PDB entries)

8. Domain d1lo2l1: 1lo2 L:1-112 [74125]
   Other proteins in same PDB: d1lo2h1, d1lo2h2, d1lo2l2, d1lo2x2, d1lo2y1, d1lo2y2
   part of retro Diels-Alder catalytic Fab 9D9
   complexed with ox1

Details for d1lo2l1

PDB Entry: 1lo2, 2 Å

PDB Description: retro-diels-alderase catalytic antibody

SCOP Domain Sequences for d1lo2l1:

Sequence; same for both SEQRES and ATOM records:

>d1lo2l1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvlmtqtplslpvslgdqvsifctssqtivhtngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrvetedlgiyycfqgshfplafgagtklelk

Timeline for d1lo2l1:

• d1lo2l1 first appeared in SCOP 1.61
  
• d1lo2l1 appears in SCOP 1.63
  
• d1lo2l1 appears in SCOP 1.67
  
• d1lo2l1 appears in the current release, SCOPe 2.08