SCOP 1.65: Domain d1lo0y1: 1lo0 Y:1-119

Lineage for d1lo0y1 (1lo0 Y:1-119)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (14 PDB entries)

8. Domain d1lo0y1: 1lo0 Y:1-119 [74121]
   Other proteins in same PDB: d1lo0h2, d1lo0l1, d1lo0l2, d1lo0x1, d1lo0x2, d1lo0y2

Details for d1lo0y1

PDB Entry: 1lo0, 2 Å

PDB Description: Catalytic Retro-Diels-Alderase Transition State Analogue Complex

SCOP Domain Sequences for d1lo0y1:

Sequence; same for both SEQRES and ATOM records:

>d1lo0y1 b.1.1.1 (Y:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1}
evklvesggglvkpggslklscaasgfsfrnygmswvrqtpekrlewvasisyggliyyp
dsikgrftisrdiaqnilylqmsslrsedtamyhcirgdsflvwftfwgqgtlvtvsa

Timeline for d1lo0y1:

• d1lo0y1 first appeared in SCOP 1.61
  
• d1lo0y1 appears in SCOP 1.63
  
• d1lo0y1 appears in SCOP 1.67
  
• d1lo0y1 appears in the current release, SCOPe 2.08