SCOP 1.63: Domain d1lo0l2: 1lo0 L:113-220

Lineage for d1lo0l2 (1lo0 L:113-220)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain [74828] (4 PDB entries)

8. Domain d1lo0l2: 1lo0 L:113-220 [74118]
   Other proteins in same PDB: d1lo0h1, d1lo0l1, d1lo0x1, d1lo0y1

Details for d1lo0l2

PDB Entry: 1lo0, 2 Å

PDB Description: Catalytic Retro-Diels-Alderase Transition State Analogue Complex

SCOP Domain Sequences for d1lo0l2:

Sequence; same for both SEQRES and ATOM records:

>d1lo0l2 b.1.1.2 (L:113-220) Immunoglobulin (constant domains of L and H chains) {Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1lo0l2:

• d1lo0l2 first appeared in SCOP 1.61
  
• d1lo0l2 appears in SCOP 1.65
  
• d1lo0l2 appears in the current release, SCOPe 2.08