Lineage for d1lo0h2 (1lo0 H:120-221)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221924Species Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain [74828] (4 PDB entries)
  8. 221925Domain d1lo0h2: 1lo0 H:120-221 [74116]
    Other proteins in same PDB: d1lo0h1, d1lo0l1, d1lo0x1, d1lo0y1
    complexed with bc1

Details for d1lo0h2

PDB Entry: 1lo0 (more details), 2 Å

PDB Description: Catalytic Retro-Diels-Alderase Transition State Analogue Complex
PDB Compounds: (H:)

SCOP Domain Sequences for d1lo0h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lo0h2 b.1.1.2 (H:120-221) Immunoglobulin (constant domains of L and H chains) {Retro Diels-Alder catalytic Fab 9D9 (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstqvdkkieprgp

SCOP Domain Coordinates for d1lo0h2:

Click to download the PDB-style file with coordinates for d1lo0h2.
(The format of our PDB-style files is described here.)

Timeline for d1lo0h2: